Lineage for d3wnwg_ (3wnw G:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729675Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1729676Protein automated matches [190036] (33 species)
    not a true protein
  7. 1729794Species Mus musculus [TaxId:10090] [268023] (1 PDB entry)
  8. 1729801Domain d3wnwg_: 3wnw G: [268041]
    automated match to d3vnxa_
    complexed with fe, gol, k, mg

Details for d3wnwg_

PDB Entry: 3wnw (more details), 2.24 Å

PDB Description: Structure of Mouse H-chain modified ferritin
PDB Compounds: (G:) ferritin heavy chain

SCOPe Domain Sequences for d3wnwg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wnwg_ a.25.1.0 (G:) automated matches {Mus musculus [TaxId: 10090]}
spsqvrqnyhqdaeaainrqinlelyasyvylsmscyfdrddvalknfakyflhqsheer
ehaeklmklqnqrggriflqdikkpdrddwesglnamecalhleksvnqsllelhklatd
kndphlcdfietyylseqvksikelgdhvtnlrkmgapeagmaeylfdkhtlgh

SCOPe Domain Coordinates for d3wnwg_:

Click to download the PDB-style file with coordinates for d3wnwg_.
(The format of our PDB-style files is described here.)

Timeline for d3wnwg_: