Lineage for d2mjla1 (2mjl A:3-197)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2140812Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2142123Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) (S)
  5. 2142137Family c.56.3.0: automated matches [193325] (1 protein)
    not a true family
  6. 2142138Protein automated matches [193326] (10 species)
    not a true protein
  7. 2142220Species Vibrio cholerae [TaxId:579112] [268011] (1 PDB entry)
  8. 2142221Domain d2mjla1: 2mjl A:3-197 [268012]
    Other proteins in same PDB: d2mjla2
    automated match to d2lgja_

Details for d2mjla1

PDB Entry: 2mjl (more details)

PDB Description: Solution structure of peptidyl-tRNA hyrolase from Vibrio cholerae
PDB Compounds: (A:) Peptidyl-tRNA hydrolase

SCOPe Domain Sequences for d2mjla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mjla1 c.56.3.0 (A:3-197) automated matches {Vibrio cholerae [TaxId: 579112]}
sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel
rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghnglkd
tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqecldaavdesvrcleilmkd
gltkaqnrlhtfkae

SCOPe Domain Coordinates for d2mjla1:

Click to download the PDB-style file with coordinates for d2mjla1.
(The format of our PDB-style files is described here.)

Timeline for d2mjla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mjla2