SCOP 1.73: Domain d6fiva_: 6fiv A:

Lineage for d6fiva_ (6fiv A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Feline immunodeficiency virus (FIV) protease [50638] (1 species)

7. Species Feline immunodeficiency virus [TaxId:11673] [50639] (7 PDB entries)

8. Domain d6fiva_: 6fiv A: [26763]
   complexed with inh, sul

Details for d6fiva_

PDB Entry: 6fiv, 1.9 Å

PDB Description: structural studies of hiv and fiv proteases complexed with an efficient inhibitor of fiv pr

PDB Compounds: (A:) retropepsin

SCOP Domain Sequences for d6fiva_:

Sequence; same for both SEQRES and ATOM records:

>d6fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]}
gttttlekrpeilifvngypikflldtgaditilnrrdfqvknsiengrqnmigvgggkr
gtnyinvhleirdenyktqcifgnvcvlednslivpllgrdnmikfnirlvm

Timeline for d6fiva_:

• d6fiva_ first appeared (with stable ids) in SCOP 1.55
  
• d6fiva_ appears in SCOP 1.71
  
• d6fiva_ appears in SCOP 1.75
  
• d6fiva_ appears in the current release, SCOPe 2.08