Lineage for d1ytha_ (1yth A:)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803906Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 803907Superfamily b.50.1: Acid proteases [50630] (3 families) (S)
  5. 803908Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 804470Protein Simian immunodeficiency virus (SIV) protease [50636] (1 species)
  7. 804471Species Simian immunodeficiency virus, different strains [TaxId:11723] [50637] (16 PDB entries)
  8. 804487Domain d1ytha_: 1yth A: [26752]

Details for d1ytha_

PDB Entry: 1yth (more details), 2.2 Å

PDB Description: siv protease crystallized with peptide product
PDB Compounds: (A:) hiv protease

SCOP Domain Sequences for d1ytha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytha_ b.50.1.1 (A:) Simian immunodeficiency virus (SIV) protease {Simian immunodeficiency virus, different strains [TaxId: 11723]}
pqitlwkrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveicghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d1ytha_:

Click to download the PDB-style file with coordinates for d1ytha_.
(The format of our PDB-style files is described here.)

Timeline for d1ytha_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ythb_