SCOPe 2.06: Domain d4uove_: 4uov E:

Lineage for d4uove_ (4uov E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
   single sheet; 10 strands

4. Superfamily b.74.1: Carbonic anhydrase [51069] (2 families)

5. Family b.74.1.0: automated matches [191576] (1 protein)
   not a true family

6. Protein automated matches [191011] (13 species)
   not a true protein

7. Species Thermovibrio ammonificans [TaxId:228745] [259326] (2 PDB entries)

8. Domain d4uove_: 4uov E: [267464]
   automated match to d4c3ta_
   complexed with azm, b3p, cl, pe3, peg, pg5, pge, so4, tla, zn

Details for d4uove_

PDB Entry: 4uov, 1.85 Å

PDB Description: The structure of a tetrameric alpha-carbonic anhydrase from Thermovibrio ammonificans reveals a core formed around intermolecular disulfides, which contribute to its thermostability.

PDB Compounds: (E:) Carbonate dehydratase

SCOPe Domain Sequences for d4uove_:

Sequence; same for both SEQRES and ATOM records:

>d4uove_ b.74.1.0 (E:) automated matches {Thermovibrio ammonificans [TaxId: 228745]}
gahwgysgsigpehwgdlspeylmckigknqspidinsadavkaclapvsvyyvsdakyv
vnnghtikvvmggrgyvvvdgkrfylkqfhfhapsehtvngkhypfeahfvhldkngnit
vlgvffkvgkenpelekvwrvmpeepgqkrhltaridpekllpenrdyyrysgslttppc
segvrwivfkepvemsreqlekfrkvmgfdnnrpvqplnarkvmk

Timeline for d4uove_:

• d4uove_ first appeared in SCOPe 2.05
  
• d4uove_ appears in SCOPe 2.07
  
• d4uove_ appears in the current release, SCOPe 2.08