Lineage for d4uofb_ (4uof B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951070Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) (S)
  5. 2951611Family d.58.6.0: automated matches [191597] (1 protein)
    not a true family
  6. 2951612Protein automated matches [191087] (19 species)
    not a true protein
  7. 2951824Species Pacific white shrimp (Litopenaeus vannamei) [TaxId:6689] [259554] (3 PDB entries)
  8. 2951829Domain d4uofb_: 4uof B: [267455]
    automated match to d4uoha_
    complexed with dat, mg

Details for d4uofb_

PDB Entry: 4uof (more details), 2.1 Å

PDB Description: Crystallographic structure of nucleoside diphosphate kinase from Litopenaeus vannamei complexed with dADP
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOPe Domain Sequences for d4uofb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4uofb_ d.58.6.0 (B:) automated matches {Pacific white shrimp (Litopenaeus vannamei) [TaxId: 6689]}
mvrertfiavkpdgvqrgligeiikrfeakgfklagmkyiqasedllkqhyidladkpfy
pglckymssgpvvamcwegtgvvktarvmmgetrpadskpgtirgdfcievgrniihgsd
svesankeialwfkpeelvswtqtneswiye

SCOPe Domain Coordinates for d4uofb_:

Click to download the PDB-style file with coordinates for d4uofb_.
(The format of our PDB-style files is described here.)

Timeline for d4uofb_: