Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
Protein automated matches [190291] (19 species) not a true protein |
Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258560] (6 PDB entries) |
Domain d4uo7c_: 4uo7 C: [267448] Other proteins in same PDB: d4uo7b1, d4uo7b2, d4uo7d1, d4uo7d2, d4uo7f1, d4uo7f2 automated match to d4unzc_ complexed with nag, so4 |
PDB Entry: 4uo7 (more details), 3 Å
SCOPe Domain Sequences for d4uo7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4uo7c_ b.19.1.2 (C:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]} nntatlclghhavangtlvktmsddqievtnatelvqsismgkicnksyrildgrnctli damlgdphcdafqyeswdlfiersnafsncypydipdyaslrsivassgtveftaegftw tgvtqngrsgackrgsadsffsrlnwltksgssyptlnvtmpnnknfdklyiwgihhpss nqeqtklyiqesgrvtvstkrsqqtiipnigsrplvrgqsgrisiywtivkpgdilmins ngnlvaprgyfklntgkssvmrsdvpidicvsecitpngsisndkpfqnvnkvtygkcpk yirqntlklatgmrnvpek
Timeline for d4uo7c_: