SCOPe 2.05: Domain d4uo7b_: 4uo7 B:

Lineage for d4uo7b_ (4uo7 B:)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (10 species)
   not a true protein

7. Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258565] (4 PDB entries)

8. Domain d4uo7b_: 4uo7 B: [267447]
   Other proteins in same PDB: d4uo7a_, d4uo7c_, d4uo7e_
   automated match to d4uo4b_
   complexed with nag, so4

Details for d4uo7b_

PDB Entry: 4uo7, 3 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with 6so4 sialyl lewis x

PDB Compounds: (B:) haemagglutinin ha2

SCOPe Domain Sequences for d4uo7b_:

Sequence; same for both SEQRES and ATOM records:

>d4uo7b_ h.3.1.0 (B:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfqsg

Timeline for d4uo7b_:

• d4uo7b_ is new in SCOPe 2.05-stable
  
• d4uo7b_ is called d4uo7b1 in SCOPe 2.06
  
• d4uo7b_ appears in the current release, SCOPe 2.08, called d4uo7b1