SCOPe 2.07: Domain d4uo6b1: 4uo6 B:1-172

Lineage for d4uo6b1 (4uo6 B:1-172)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.0: automated matches [254278] (1 protein)
   not a true family

6. Protein automated matches [254645] (42 species)
   not a true protein

7. Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258563] (5 PDB entries)

8. Domain d4uo6b1: 4uo6 B:1-172 [267445]
   Other proteins in same PDB: d4uo6a_, d4uo6b2
   automated match to d4uo4b_
   complexed with nag, so4

Details for d4uo6b1

PDB Entry: 4uo6, 2.9 Å

PDB Description: structure of the a_canine_colorado_17864_06 h3 haemagglutinin in complex with sialyl lewis x

PDB Compounds: (B:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4uo6b1:

Sequence; same for both SEQRES and ATOM records:

>d4uo6b1 h.3.1.0 (B:1-172) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgdgcfkiyhkcdnaciesirtgtydhyiyrdealnnrfq

Timeline for d4uo6b1:

• d4uo6b1 first appeared in SCOPe 2.05, called d4uo6b_
  
• d4uo6b1 appears in SCOPe 2.06
  
• d4uo6b1 appears in the current release, SCOPe 2.08