SCOPe 2.08: Domain d4uo0f_: 4uo0 F:

Lineage for d4uo0f_ (4uo0 F:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
   core: trimeric coiled coil

4. Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families)

5. Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)

6. Protein automated matches [254646] (29 species)
   not a true protein

7. Species Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId:560387] [258556] (3 PDB entries)

8. Domain d4uo0f_: 4uo0 F: [267443]
   Other proteins in same PDB: d4uo0a_, d4uo0c_, d4uo0e_
   automated match to d4uo1b_
   complexed with bma, edo, nag

Details for d4uo0f_

PDB Entry: 4uo0, 1.9 Å

PDB Description: structure of the a_equine_richmond_07 h3 haemagglutinin

PDB Compounds: (F:) Hemagglutinin

SCOPe Domain Sequences for d4uo0f_:

Sequence; same for both SEQRES and ATOM records:

>d4uo0f_ h.3.1.1 (F:) automated matches {Influenza A virus (a/equine/richmond/1/2007)(h3n8)) [TaxId: 560387]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqtaidqineklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

Timeline for d4uo0f_:

• d4uo0f_ first appeared in SCOPe 2.05
  
• d4uo0f_ appears in SCOPe 2.07