SCOPe 2.05: Domain d4unye_: 4uny E:

Lineage for d4unye_ (4uny E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (24 species)
   not a true protein

7. Species Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [258569] (5 PDB entries)

8. Domain d4unye_: 4uny E: [267436]
   Other proteins in same PDB: d4unyb_, d4unyd_, d4unyf_
   automated match to d4unzc_
   complexed with nag

Details for d4unye_

PDB Entry: 4uny, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln

PDB Compounds: (E:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unye_:

Sequence; same for both SEQRES and ATOM records:

>d4unye_ b.19.1.2 (E:) automated matches {Influenza a virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli
damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw
tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss
nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk
yirqntlklatgmrnvpekqi

Timeline for d4unye_:

• d4unye_ is new in SCOPe 2.05-stable
  
• d4unye_ appears in SCOPe 2.06
  
• d4unye_ appears in the current release, SCOPe 2.08