Lineage for d4unyd_ (4uny D:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2645404Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2645405Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2645406Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2645931Protein automated matches [254646] (36 species)
    not a true protein
  7. 2645936Species Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId:867285] [267994] (1 PDB entry)
  8. 2645938Domain d4unyd_: 4uny D: [267435]
    Other proteins in same PDB: d4unya_, d4unyc1, d4unyc2, d4unye_
    automated match to d4unzb_
    complexed with nag

Details for d4unyd_

PDB Entry: 4uny (more details), 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-3sln
PDB Compounds: (D:) h3 haemagglutinin ha2 chain

SCOPe Domain Sequences for d4unyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4unyd_ h.3.1.1 (D:) automated matches {Influenza A virus (a/canine/colorado/17864/2006(h3n8)) [TaxId: 867285]}
gifgaiagfiengwegmvdgwygfryqnsegtgqaadlkstqaaidqingklnrviertn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdaemnklfe
ktrrqlrenaedmgggcfkiyhkcdnacigsirngtydhyiyrdealnnrfq

SCOPe Domain Coordinates for d4unyd_:

Click to download the PDB-style file with coordinates for d4unyd_.
(The format of our PDB-style files is described here.)

Timeline for d4unyd_: