SCOPe 2.08: Domain d4r4qa1: 4r4q A:1-120

Lineage for d4r4qa1 (4r4q A:1-120)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (14 proteins)
   barrel, closed; n=5, S=10

6. Protein automated matches [190206] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186959] (27 PDB entries)

8. Domain d4r4qa1: 4r4q A:1-120 [267376]
   Other proteins in same PDB: d4r4qa2
   automated match to d4ipca_
   complexed with 3hz

Details for d4r4qa1

PDB Entry: 4r4q, 1.35 Å

PDB Description: crystal structure of rpa70n in complex with 5-(3-((n-(4-(5- carboxyfuran-2-yl)benzyl)acetamido)methyl)phenyl)-1-(3,4- dichlorophenyl)-1h-pyrazole-3-carboxylic acid

PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d4r4qa1:

Sequence; same for both SEQRES and ATOM records:

>d4r4qa1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

Timeline for d4r4qa1:

• d4r4qa1 first appeared in SCOPe 2.05, called d4r4qa_
  
• d4r4qa1 appears in SCOPe 2.07