SCOPe 2.08: Domain d4qtga_: 4qtg A:

Lineage for d4qtga_ (4qtg A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families)
   the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
   has transition metal ions bound inside the barrel

5. Family c.1.9.0: automated matches [191327] (1 protein)
   not a true family

6. Protein automated matches [190150] (36 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:279238] [267952] (6 PDB entries)

8. Domain d4qtga_: 4qtg A: [267365]
   automated match to d3s4ta_
   complexed with gol, mn

Details for d4qtga_

PDB Entry: 4qtg, 1.47 Å

PDB Description: crystal structure of 5-carboxyvanillate decarboxylase ligw2 (target efi-505250) from novosphingobium aromaticivorans dsm 12444 complexed with manganese

PDB Compounds: (A:) 5-carboxyvanillate decarboxylase

SCOPe Domain Sequences for d4qtga_:

Sequence; same for both SEQRES and ATOM records:

>d4qtga_ c.1.9.0 (A:) automated matches {Novosphingobium aromaticivorans [TaxId: 279238]}
dlktggeqgylriateeafatreiidvylrmirdgtadkgmvslwgfyaqspseratqil
erlldlgerriadmdatgidkailaltspgvqplhdldeartlatrandtladacqkypd
rfigmgtvapqdpewsareihrgarelgfkgiqinshtqgryldeeffdpifralvevdq
plyihpatspdsmidpmleagldgaifgfgvetgmhllrlitigifdkypslqimvghmg
ealpywlyrldymhqagvrsqryermkplkktiegylksnvlvtnsgvawepaikfcqqv
mgedrvmyamdypyqyvadevramdamdmsaqtkkkffqtnaekwfkl

Timeline for d4qtga_:

• d4qtga_ first appeared in SCOPe 2.05
  
• d4qtga_ appears in SCOPe 2.07