Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein automated matches [190118] (12 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries) |
Domain d4q5hb_: 4q5h B: [267268] Other proteins in same PDB: d4q5hc1, d4q5hc2 automated match to d4q5eb_ complexed with anp, mg |
PDB Entry: 4q5h (more details), 2 Å
SCOPe Domain Sequences for d4q5hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4q5hb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn iqkestlhlvlrlrgc
Timeline for d4q5hb_: