SCOPe 2.06: Domain d4q5hb_: 4q5h B:

Lineage for d4q5hb_ (4q5h B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
   Pfam PF00240

6. Protein automated matches [190118] (12 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [193751] (7 PDB entries)

8. Domain d4q5hb_: 4q5h B: [267268]
   Other proteins in same PDB: d4q5hc1, d4q5hc2
   automated match to d4q5eb_
   complexed with anp, mg

Details for d4q5hb_

PDB Entry: 4q5h, 2 Å

PDB Description: shigella effector kinase ospg bound to amppnp and e2-ub ubch7-ub conjugate

PDB Compounds: (B:) Polyubiquitin

SCOPe Domain Sequences for d4q5hb_:

Sequence; same for both SEQRES and ATOM records:

>d4q5hb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgc

Timeline for d4q5hb_:

• d4q5hb_ first appeared in SCOPe 2.05
  
• d4q5hb_ appears in SCOPe 2.07
  
• d4q5hb_ appears in the current release, SCOPe 2.08