Lineage for d4prfa_ (4prf A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1906287Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1908438Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 1908439Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 1908745Protein Splicesomal U1A protein [54932] (2 species)
    duplication: contains two domains of this fold
  7. 1908750Species Human (Homo sapiens) [TaxId:9606] [54933] (48 PDB entries)
    Uniprot P09012 1-97 ! Uniprot P09012 4-98 ! Uniprot P09012 1-98
  8. 1908773Domain d4prfa_: 4prf A: [267209]
    protein/RNA complex; complexed with sr

Details for d4prfa_

PDB Entry: 4prf (more details), 2.4 Å

PDB Description: A Second Look at the HDV Ribozyme Structure and Dynamics.
PDB Compounds: (A:) U1 small nuclear ribonucleoprotein A

SCOPe Domain Sequences for d4prfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4prfa_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]}
petrpnhtiyinnlnekikkdelkkslhaifsrfgqildilvsrslkmrgqafvifkevs
satnalrsmqgfpfydkpmriqyaktdsdiiakmk

SCOPe Domain Coordinates for d4prfa_:

Click to download the PDB-style file with coordinates for d4prfa_.
(The format of our PDB-style files is described here.)

Timeline for d4prfa_: