Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) |
Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins) automatically mapped to Pfam PF07737 |
Protein automated matches [234341] (1 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234342] (14 PDB entries) |
Domain d4pksa2: 4pks A:551-776 [267185] Other proteins in same PDB: d4pksa1 automated match to d1j7na2 complexed with 30h, edo, gol, zn |
PDB Entry: 4pks (more details), 2.3 Å
SCOPe Domain Sequences for d4pksa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pksa2 d.92.1.14 (A:551-776) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiins
Timeline for d4pksa2: