Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
Protein automated matches [190133] (7 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries) |
Domain d4pksa1: 4pks A:267-550 [267184] Other proteins in same PDB: d4pksa2 automated match to d1j7na3 complexed with 30h, edo, gol, zn |
PDB Entry: 4pks (more details), 2.3 Å
SCOPe Domain Sequences for d4pksa1:
Sequence, based on SEQRES records: (download)
>d4pksa1 d.166.1.1 (A:267-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids sdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqpy dinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninnl tatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriqls pdtragylengklilqrnigleikdvqiikqsekeyiridakvv
>d4pksa1 d.166.1.1 (A:267-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqids sdflsteekeflkklqidiekekeflkklkldiqpydinqrlqdtgglidspsinldvrk qykrdiqnidallhqsigstlynkiylyenmninnltatlgadlvdstdntkinrgifne fkknfkysissnymivdinerpaldnerlkwriqlspdtragylengklilqrnigleik dvqiikqsekeyiridakvv
Timeline for d4pksa1: