SCOPe 2.05: Domain d4pkqa1: 4pkq A:266-550

Lineage for d4pkqa1 (4pkq A:266-550)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein automated matches [190133] (5 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [234339] (15 PDB entries)

8. Domain d4pkqa1: 4pkq A:266-550 [267182]
   Other proteins in same PDB: d4pkqa2
   automated match to d1j7na3
   complexed with edo, pge, zn

Details for d4pkqa1

PDB Entry: 4pkq, 2.2 Å

PDB Description: anthrax toxin lethal factor with bound zinc

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d4pkqa1:

Sequence; same for both SEQRES and ATOM records:

>d4pkqa1 d.166.1.1 (A:266-550) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
sryekwekikqhyqhwsdslseegrgllkklqipiepkkddiihslsqeekellkriqid
ssdflsteekeflkklqidirdslseeekellnriqvdssnplsekekeflkklkldiqp
ydinqrlqdtgglidspsinldvrkqykrdiqnidallhqsigstlynkiylyenmninn
ltatlgadlvdstdntkinrgifnefkknfkysissnymivdinerpaldnerlkwriql
spdtragylengklilqrnigleikdvqiikqsekeyiridakvv

Timeline for d4pkqa1:

• d4pkqa1 is new in SCOPe 2.05-stable
  
• d4pkqa1 appears in SCOPe 2.06
  
• d4pkqa1 appears in the current release, SCOPe 2.08