Class a: All alpha proteins [46456] (286 folds) |
Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
Superfamily a.118.1: ARM repeat [48371] (26 families) |
Family a.118.1.0: automated matches [191340] (1 protein) not a true family |
Protein automated matches [190220] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries) |
Domain d4pj6b4: 4pj6 B:707-1025 [267181] Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a3, d4pj6b1, d4pj6b2, d4pj6b3 automated match to d4p8qa4 complexed with lys, nag, zn |
PDB Entry: 4pj6 (more details), 2.96 Å
SCOPe Domain Sequences for d4pj6b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pj6b4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]} ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev iqlniqwmeknlksltwwl
Timeline for d4pj6b4:
View in 3D Domains from other chains: (mouse over for more information) d4pj6a1, d4pj6a2, d4pj6a3, d4pj6a4 |