Lineage for d4pj6b4 (4pj6 B:707-1025)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1745105Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1745106Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 1745667Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 1745668Protein automated matches [190220] (12 species)
    not a true protein
  7. 1745698Species Human (Homo sapiens) [TaxId:9606] [189070] (29 PDB entries)
  8. 1745731Domain d4pj6b4: 4pj6 B:707-1025 [267181]
    Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a3, d4pj6b1, d4pj6b2, d4pj6b3
    automated match to d4p8qa4
    complexed with lys, nag, zn

Details for d4pj6b4

PDB Entry: 4pj6 (more details), 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site
PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6b4:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pj6b4 a.118.1.0 (B:707-1025) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddwealihqlkinpyvlsdkdranlinnifelaglgkvplkrafdlinylgnenhtapit
ealfqtdliynlleklgymdlasrlvtrvfkllqnqiqqqtwtdegtpsmrelrsallef
acthnlgncsttamklfddwmasngtqslptdvmttvfkvgaktdkgwsfllgkyisigs
eaeknkilealassedvrklywlmksslngdnfrtqklsfiirtvgrhfpghllawdfvk
enwnklvqkfplgsytiqnivagstylfstkthlsevqaffenqseatfrlrcvqealev
iqlniqwmeknlksltwwl

SCOPe Domain Coordinates for d4pj6b4:

Click to download the PDB-style file with coordinates for d4pj6b4.
(The format of our PDB-style files is described here.)

Timeline for d4pj6b4: