Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) same topology as (b.1.15.1) |
Family b.1.30.0: automated matches [254306] (1 protein) not a true family |
Protein automated matches [254707] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries) |
Domain d4pj6b3: 4pj6 B:616-706 [267180] Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a4, d4pj6b1, d4pj6b2, d4pj6b4 automated match to d4p8qa3 complexed with lys, nag, zn |
PDB Entry: 4pj6 (more details), 2.96 Å
SCOPe Domain Sequences for d4pj6b3:
Sequence, based on SEQRES records: (download)
>d4pj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld kksgvinlteevlwvkvninmngyyivhyad
>d4pj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]} fplvtvqkkgkelfiqqerfflntsylwhiplsyvtenyskyqsvslldkksgvinltee vlwvkvninmngyyivhyad
Timeline for d4pj6b3:
View in 3D Domains from other chains: (mouse over for more information) d4pj6a1, d4pj6a2, d4pj6a3, d4pj6a4 |