SCOPe 2.05: Domain d4pj6b3: 4pj6 B:616-706

Lineage for d4pj6b3 (4pj6 B:616-706)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families)
   same topology as (b.1.15.1)

5. Family b.1.30.0: automated matches [254306] (1 protein)
   not a true family

6. Protein automated matches [254707] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255965] (11 PDB entries)

8. Domain d4pj6b3: 4pj6 B:616-706 [267180]
   Other proteins in same PDB: d4pj6a1, d4pj6a2, d4pj6a4, d4pj6b1, d4pj6b2, d4pj6b4
   automated match to d4p8qa3
   complexed with lys, nag, zn

Details for d4pj6b3

PDB Entry: 4pj6, 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site

PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6b3:

Sequence, based on SEQRES records:

>d4pj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflnmkpeiqpsdtsylwhiplsyvtegrnyskyqsvslld
kksgvinlteevlwvkvninmngyyivhyad

Sequence, based on observed residues (ATOM records):

>d4pj6b3 b.1.30.0 (B:616-706) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fplvtvqkkgkelfiqqerfflntsylwhiplsyvtenyskyqsvslldkksgvinltee
vlwvkvninmngyyivhyad

Timeline for d4pj6b3:

• d4pj6b3 is new in SCOPe 2.05-stable
  
• d4pj6b3 appears in SCOPe 2.06
  
• d4pj6b3 appears in the current release, SCOPe 2.08