SCOPe 2.07: Domain d4pj6b1: 4pj6 B:160-366

Lineage for d4pj6b1 (4pj6 B:160-366)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily)
   duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain

4. Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families)

5. Family b.98.1.0: automated matches [254305] (1 protein)
   not a true family

6. Protein automated matches [254706] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255964] (28 PDB entries)

8. Domain d4pj6b1: 4pj6 B:160-366 [267178]
   Other proteins in same PDB: d4pj6a2, d4pj6a3, d4pj6a4, d4pj6b2, d4pj6b3, d4pj6b4
   automated match to d4p8qa1
   complexed with lys, nag, zn

Details for d4pj6b1

PDB Entry: 4pj6, 2.96 Å

PDB Description: crystal structure of human insulin regulated aminopeptidase with lysine in active site

PDB Compounds: (B:) Leucyl-cystinyl aminopeptidase

SCOPe Domain Sequences for d4pj6b1:

Sequence, based on SEQRES records:

>d4pj6b1 b.98.1.0 (B:160-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv
tfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy
tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl
ddglvqdefsesvkmstylvafivgem

Sequence, based on observed residues (ATOM records):

>d4pj6b1 b.98.1.0 (B:160-366) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisrv
tfmekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsytdesne
kkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvlddglvq
defsesvkmstylvafivgem

Timeline for d4pj6b1:

• d4pj6b1 first appeared in SCOPe 2.05
  
• d4pj6b1 appears in SCOPe 2.06
  
• d4pj6b1 appears in the current release, SCOPe 2.08