Class b: All beta proteins [48724] (176 folds) |
Fold b.98: Zn aminopeptidase N-terminal domain [63736] (1 superfamily) duplication: two beta-sandwiches of similar topologies are fused together in a single three beta-sheet domain |
Superfamily b.98.1: Zn aminopeptidase N-terminal domain [63737] (2 families) |
Family b.98.1.0: automated matches [254305] (1 protein) not a true family |
Protein automated matches [254706] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255964] (11 PDB entries) |
Domain d4pj6a1: 4pj6 A:159-366 [267174] Other proteins in same PDB: d4pj6a2, d4pj6a3, d4pj6a4, d4pj6b2, d4pj6b3, d4pj6b4 automated match to d4p8qa1 complexed with lys, nag, zn |
PDB Entry: 4pj6 (more details), 2.96 Å
SCOPe Domain Sequences for d4pj6a1:
Sequence, based on SEQRES records: (download)
>d4pj6a1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]} klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr vtfmsavssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfs ytdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvv lddglvqdefsesvkmstylvafivgem
>d4pj6a1 b.98.1.0 (A:159-366) automated matches {Human (Homo sapiens) [TaxId: 9606]} klfpwaqirlptavvplryelslhpnltsmtfrgsvtisvqalqvtwniilhstghnisr vtfmsvssqekqaeileyayhgqiaivapeallaghnytlkieysanisssyygfygfsy tdesnekkyfaatqfeplaarsafpcfdepafkatfiikiirdeqytalsnmpkkssvvl ddglvqdefsesvkmstylvafivgem
Timeline for d4pj6a1:
View in 3D Domains from other chains: (mouse over for more information) d4pj6b1, d4pj6b2, d4pj6b3, d4pj6b4 |