SCOPe 2.06: Domain d4phhb_: 4phh B:

Lineage for d4phhb_ (4phh B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (5 PDB entries)

8. Domain d4phhb_: 4phh B: [267167]
   automated match to d4rkea_
   complexed with 2uk, cl, mg

Details for d4phhb_

PDB Entry: 4phh, 2.35 Å

PDB Description: crystal structure of ypt7 covalently modified with gnp

PDB Compounds: (B:) GTP-binding protein YPT7

SCOPe Domain Sequences for d4phhb_:

Sequence, based on SEQRES records:

>d4phhb_ c.37.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkvatmqvwdtag
qerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnk
idaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa

Sequence, based on observed residues (ATOM records):

>d4phhb_ c.37.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ilkviilgdsgvgktslmhryvndkyscatigadfltkevtvdgdkvatmqvwdtagqer
fqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkida
eeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnqa

Timeline for d4phhb_:

• d4phhb_ first appeared in SCOPe 2.05
  
• d4phhb_ appears in SCOPe 2.07
  
• d4phhb_ appears in the current release, SCOPe 2.08