Lineage for d4phha_ (4phh A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (158 species)
    not a true protein
  7. 2871712Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [226311] (6 PDB entries)
  8. 2871720Domain d4phha_: 4phh A: [267166]
    automated match to d4rkea_
    complexed with 2uk, cl, mg

Details for d4phha_

PDB Entry: 4phh (more details), 2.35 Å

PDB Description: crystal structure of ypt7 covalently modified with gnp
PDB Compounds: (A:) GTP-binding protein YPT7

SCOPe Domain Sequences for d4phha_:

Sequence, based on SEQRES records: (download)

>d4phha_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkvatmqvwdtag
qerfqslgvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnk
idaeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq

Sequence, based on observed residues (ATOM records): (download)

>d4phha_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
ilkviilgdsgvgktslmhryvndkyscqykatigadfltkevtvdgdkvatmqvwdtag
qerfqsvafyrgadccvlvydvtnassfenikswrdeflvhanvnspetfpfvilgnkid
aeeskkivseksaqelakslgdiplfltsaknainvdtafeeiarsalqqnq

SCOPe Domain Coordinates for d4phha_:

Click to download the PDB-style file with coordinates for d4phha_.
(The format of our PDB-style files is described here.)

Timeline for d4phha_: