Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (161 species) not a true protein |
Species Ruegeria pomeroyi [TaxId:246200] [267988] (3 PDB entries) |
Domain d4pafa1: 4paf A:27-327 [267149] Other proteins in same PDB: d4pafa2 automated match to d4mnpa_ complexed with dhb, mli |
PDB Entry: 4paf (more details), 1.6 Å
SCOPe Domain Sequences for d4pafa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pafa1 c.94.1.0 (A:27-327) automated matches {Ruegeria pomeroyi [TaxId: 246200]} kefrlglitpsphtwtkaaeafgaelseksggahsvsvfparqlgneaqmlqqlqtgald mafmtvaevsnrvpnmgafyapylagdinhaaailrsdtargmlavlpqeagvvgvgfgs agmrqilsrgavnsaadlsglklritpfdpildfynalgaaptpmplpavydalangqvd aidmdvelinvlkchehadtilisnhmmfpmvglisarvyagmsdadkamiselmakhvd stldvymvkepewtdaltkvgktfkrvdqsffgdaiaqwetiwadkapslpelrktaadl q
Timeline for d4pafa1: