SCOP 1.71: Domain d2hvp__: 2hvp -

Lineage for d2hvp__ (2hvp -)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (8 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (179 PDB entries)

8. Domain d2hvp__: 2hvp - [26712]
   CA-atoms only

Details for d2hvp__

PDB Entry: 2hvp, 3 Å

PDB Description: three-dimensional structure of aspartyl protease from human immunodeficiency virus hiv-1

SCOP Domain Sequences for d2hvp__:

Sequence; same for both SEQRES and ATOM records:

>d2hvp__ b.50.1.1 (-) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
wqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqydqilie
icghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d2hvp__:

• d2hvp__ first appeared (with stable ids) in SCOP 1.55
  
• d2hvp__ appears in SCOP 1.69
  
• d2hvp__ is called d2hvpa_ in SCOP 1.73
  
• d2hvp__ appears in the current release, SCOPe 2.08, called d2hvpa_