Lineage for d2hvp__ (2hvp -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15927Domain d2hvp__: 2hvp - [26712]

Details for d2hvp__

PDB Entry: 2hvp (more details), 3 Å

PDB Description: three-dimensional structure of aspartyl protease from human immunodeficiency virus hiv-1

SCOP Domain Sequences for d2hvp__:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hvp__ b.50.1.1 (-) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
wqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqydqilie
icghkaigtvlvgptpvniigrnlltqigctlnf

SCOP Domain Coordinates for d2hvp__:

Click to download the PDB-style file with coordinates for d2hvp__.
(The format of our PDB-style files is described here.)

Timeline for d2hvp__: