SCOP 1.55: Domain d9hvpa_: 9hvp A:

Lineage for d9hvpa_ (9hvp A:)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)

8. Domain d9hvpa_: 9hvp A: [26708]

Details for d9hvpa_

PDB Entry: 9hvp, 2.8 Å

PDB Description: design, activity and 2.8 angstroms crystal structure of a c2 symmetric inhibitor complexed to hiv-1 protease

SCOP Domain Sequences for d9hvpa_:

Sequence; same for both SEQRES and ATOM records:

>d9hvpa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

Timeline for d9hvpa_:

• d9hvpa_ appears in SCOP 1.57
  
• d9hvpa_ appears in the current release, SCOPe 2.08