SCOPe 2.05: Domain d4oiim2: 4oii M:108-213

Lineage for d4oiim2 (4oii M:108-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4oiim2: 4oii M:108-213 [267053]
   Other proteins in same PDB: d4oiil1, d4oiim1
   automated match to d3ojda2

Details for d4oiim2

PDB Entry: 4oii, 3 Å

PDB Description: west nile virus ns1 in complex with neutralizing 22ns1 antibody fab

PDB Compounds: (M:) Light Chain of Fab fragment of 22NS1 Antibody

SCOPe Domain Sequences for d4oiim2:

Sequence; same for both SEQRES and ATOM records:

>d4oiim2 b.1.1.2 (M:108-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4oiim2:

• d4oiim2 is new in SCOPe 2.05-stable
  
• d4oiim2 appears in SCOPe 2.06
  
• d4oiim2 appears in the current release, SCOPe 2.08