Lineage for d4ofna1 (4ofn A:1-77)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880035Species Necator americanus [TaxId:51031] [224893] (6 PDB entries)
  8. 2880055Domain d4ofna1: 4ofn A:1-77 [267046]
    Other proteins in same PDB: d4ofna2, d4ofnb2
    automated match to d2on7a1
    complexed with gsh

Details for d4ofna1

PDB Entry: 4ofn (more details), 2.69 Å

PDB Description: monoclinic nagst1
PDB Compounds: (A:) Glutathione S-transferase-1

SCOPe Domain Sequences for d4ofna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ofna1 c.47.1.0 (A:1-77) automated matches {Necator americanus [TaxId: 51031]}
mvhykltyfairgagecarqifaladqefedvrldkeqfakvkpdlpfgqvpvlevdgkq
laqslaicrylarqfgf

SCOPe Domain Coordinates for d4ofna1:

Click to download the PDB-style file with coordinates for d4ofna1.
(The format of our PDB-style files is described here.)

Timeline for d4ofna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ofna2