SCOPe 2.06: Domain d4odhl1: 4odh L:2-93

Lineage for d4odhl1 (4odh L:2-93)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4odhl1: 4odh L:2-93 [267033]
   Other proteins in same PDB: d4odhl2
   automated match to d8faba1

Details for d4odhl1

PDB Entry: 4odh, 2.89 Å

PDB Description: crystal structure of human fab cap256-vrc26.uca, a potent v1v2-directed hiv-1 neutralizing antibody

PDB Compounds: (L:) CAP256-VRC26.UCA light chain

SCOPe Domain Sequences for d4odhl1:

Sequence; same for both SEQRES and ATOM records:

>d4odhl1 b.1.1.0 (L:2-93) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svltqppsvsaapgqkvtiscsgsssnignnyvswyqqlpgtapklliyennkrpsgipd
rfsgsksgtsatlgitglqtgdeadyycgtwds

Timeline for d4odhl1:

• d4odhl1 first appeared in SCOPe 2.05
  
• d4odhl1 appears in SCOPe 2.07
  
• d4odhl1 appears in the current release, SCOPe 2.08