Lineage for d4oa4c_ (4oa4 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916119Species Shewanella loihica [TaxId:323850] [267980] (2 PDB entries)
  8. 2916126Domain d4oa4c_: 4oa4 C: [267018]
    automated match to d4ovsa_
    complexed with cl, sin

Details for d4oa4c_

PDB Entry: 4oa4 (more details), 1.6 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from shewanella loihica pv-4 (shew_1446), target efi-510273, with bound succinate
PDB Compounds: (C:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4oa4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4oa4c_ c.94.1.0 (C:) automated matches {Shewanella loihica [TaxId: 323850]}
apteikfshvvaentpkgqmalkfkqlveerlpgeyqvnvfpnsqlfgdnnelsalllnd
vqfvapslskferytkklqlfdlpflfkdmdavnrfqqsdagqqllnsmkrkgvvglgyl
hngmkqfsassplvlpedaqgkkfrimasdvlaaqfqaveaipvkkpfsevftllqtrai
dgqentwsniyskkfyevqsnitesnhgvldymvvtsntfwkslpadkrkvikasldeai
aygneiaaakvnkdkqaiidskrsevtyltpeqraawvnamkpvwaqfedkigkdlidaa
vasne

SCOPe Domain Coordinates for d4oa4c_:

Click to download the PDB-style file with coordinates for d4oa4c_.
(The format of our PDB-style files is described here.)

Timeline for d4oa4c_: