Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) |
Family c.97.3.0: automated matches [267623] (1 protein) not a true family |
Protein automated matches [267670] (3 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries) |
Domain d4o8xa1: 4o8x A:2-178 [267010] Other proteins in same PDB: d4o8xa2 automated match to d2o95a_ complexed with edo, zn |
PDB Entry: 4o8x (more details), 1.99 Å
SCOPe Domain Sequences for d4o8xa1:
Sequence, based on SEQRES records: (download)
>d4o8xa1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll ivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdv
>d4o8xa1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll ivdvkqqgvglptdayvaieqtektflhlpctieaeeaeeigvehllrdv
Timeline for d4o8xa1: