SCOPe 2.06: Domain d4o8xa1: 4o8x A:2-178

Lineage for d4o8xa1 (4o8x A:2-178)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.0: automated matches [267623] (1 protein)
   not a true family

6. Protein automated matches [267670] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [267950] (10 PDB entries)

8. Domain d4o8xa1: 4o8x A:2-178 [267010]
   Other proteins in same PDB: d4o8xa2
   automated match to d2o95a_
   complexed with edo, zn

Details for d4o8xa1

PDB Entry: 4o8x, 1.99 Å

PDB Description: zinc-bound rpn11 in complex with rpn8

PDB Compounds: (A:) 26s proteasome regulatory subunit rpn8

SCOPe Domain Sequences for d4o8xa1:

Sequence, based on SEQRES records:

>d4o8xa1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqvkddgtstektflhlpctieaeeaeeigvehllrdv

Sequence, based on observed residues (ATOM records):

>d4o8xa1 c.97.3.0 (A:2-178) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
slqhekvtiaplvllsaldhyertqtkenkrcvgvilgdansstirvtnsfalpfeedek
nsdvwfldhnyienmnemckkinakekligwyhsgpklrasdlkinelfkkytqnnplll
ivdvkqqgvglptdayvaieqtektflhlpctieaeeaeeigvehllrdv

Timeline for d4o8xa1:

• d4o8xa1 first appeared in SCOPe 2.05, called d4o8xa_
  
• d4o8xa1 appears in SCOPe 2.07
  
• d4o8xa1 appears in the current release, SCOPe 2.08