Lineage for d4nqve1 (4nqv E:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937660Species Human (Homo sapiens), HLA-A1 [TaxId:9606] [117849] (2 PDB entries)
    Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor
  8. 2937663Domain d4nqve1: 4nqv E:1-181 [266971]
    Other proteins in same PDB: d4nqve2
    automated match to d1w72a2

Details for d4nqve1

PDB Entry: 4nqv (more details), 2.39 Å

PDB Description: Crystal Structure of HLA A*0101 in complex with NP44, an 9-mer influenza epitope
PDB Compounds: (E:) HLA class I histocompatibility antigen, A-1 alpha chain

SCOPe Domain Sequences for d4nqve1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nqve1 d.19.1.1 (E:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqkmeprapwieqegpeyw
dqetrnmkahsqtdranlgtlrgyynqsedgshtiqimygcdvgpdgrflrgyrqdaydg
kdyialnedlrswtaadmaaqitkrkweavhaaeqrrvylegrcvdglrrylengketlq
r

SCOPe Domain Coordinates for d4nqve1:

Click to download the PDB-style file with coordinates for d4nqve1.
(The format of our PDB-style files is described here.)

Timeline for d4nqve1: