Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.0: automated matches [191448] (1 protein) not a true family |
Protein automated matches [190683] (38 species) not a true protein |
Species Pyrobaculum sp. [TaxId:1104324] [228031] (3 PDB entries) |
Domain d4nmkg_: 4nmk G: [266953] automated match to d4nmja_ complexed with nap |
PDB Entry: 4nmk (more details), 1.9 Å
SCOPe Domain Sequences for d4nmkg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4nmkg_ c.82.1.0 (G:) automated matches {Pyrobaculum sp. [TaxId: 1104324]} mkvanyingefkepstgafqvktspvdgskiaevprsgredareaidsafealkawanip airraeylykmlevfrqmkedfmkiltvegggtyrkvwgevvfterliqnaaelarhyqg rvlqsdsestisvvfkrskgvvgvitpwnyplsismkkiahtlavgntvvykpasdtpvt gwliaqmvakaglpkgvfnlvigpgpvvgeeivthkrvahvtftgesstgreiaakaagt lktvtlelggsdpliilddvdvdyaarlavfaslfhqgqictsakriivhkavadkfier yvhyvkmlriddprkdekvdlgplinerqvalmkefvddavsrggrlliggrswgnffep aifvdvdrnfrimreevfgpvrpivvvenddqavevandtdyglsgavltnnvnrafria eavesgmfhindvtfleeshvpfggikasgvgreggewsfhettydrwvtvtlrtrrfpi psal
Timeline for d4nmkg_: