Lineage for d1c6xb_ (1c6x B:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61252Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 61253Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 61254Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 61270Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 61271Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)
  8. 61484Domain d1c6xb_: 1c6x B: [26695]

Details for d1c6xb_

PDB Entry: 1c6x (more details), 2.5 Å

PDB Description: alternate binding site for the p1-p3 group of a class of potent hiv-1 protease inhibitors as a result of concerted structural change in 80's loop.

SCOP Domain Sequences for d1c6xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c6xb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrpvvtikiggqlmealidtgaddtvleemdlpgrwkpkiiggiggfvkvrqyd
qipieicghkvigtvlvgptptniigrnlltqigctlnf

SCOP Domain Coordinates for d1c6xb_:

Click to download the PDB-style file with coordinates for d1c6xb_.
(The format of our PDB-style files is described here.)

Timeline for d1c6xb_: