Lineage for d4n92a_ (4n92 A:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1949285Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1949286Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1949287Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1949998Protein automated matches [190161] (23 species)
    not a true protein
  7. 1950001Species Bacillus licheniformis [TaxId:1402] [188244] (11 PDB entries)
  8. 1950015Domain d4n92a_: 4n92 A: [266896]
    automated match to d2blma_

Details for d4n92a_

PDB Entry: 4n92 (more details), 1.93 Å

PDB Description: Crystal structure of beta-lactamse PenP_E166S
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4n92a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n92a_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfspelnevnpgetqdtstaralvtslrafaledklpsekrellidwmkr
nttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

SCOPe Domain Coordinates for d4n92a_:

Click to download the PDB-style file with coordinates for d4n92a_.
(The format of our PDB-style files is described here.)

Timeline for d4n92a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4n92b_