SCOPe 2.08: Domain d4n8gb1: 4n8g B:28-345

Lineage for d4n8gb1 (4n8g B:28-345)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Chromohalobacter salexigens [TaxId:290398] [267970] (3 PDB entries)

8. Domain d4n8gb1: 4n8g B:28-345 [266890]
   Other proteins in same PDB: d4n8ga2, d4n8gb2
   automated match to d4mcoc_
   complexed with cl, dal, so4

Details for d4n8gb1

PDB Entry: 4n8g, 1.5 Å

PDB Description: crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0660), target efi-501075, with bound d-alanine-d-alanine

PDB Compounds: (B:) TRAP dicarboxylate transporter, DctP subunit

SCOPe Domain Sequences for d4n8gb1:

Sequence; same for both SEQRES and ATOM records:

>d4n8gb1 c.94.1.0 (B:28-345) automated matches {Chromohalobacter salexigens [TaxId: 290398]}
attlnlsyngppdtdknavhlfasnlkrlveektdgdiqlklypnsmlgeeqermeqvin
tpslniasfaglspivpeiyvsaipflfedyeaahqffdegdywnkvedtleertgaell
gvieeggfldftnskrpisspedfeglrframdpsqvalyeafgasgtpipwtdtymalk
tnvadgqmnppmyiimgslyevqkyltlanvqysdqfliangewyddlseenrqaieaav
qeaselnredvekrvderiqfladqgmevieptedelaafrekgqpayiewltdeqgidr
awiemaledagqsdllan

Timeline for d4n8gb1:

• d4n8gb1 first appeared in SCOPe 2.05, called d4n8gb_
  
• d4n8gb1 appears in SCOPe 2.07