SCOP 1.57: Domain d1bdqa_: 1bdq A:

Lineage for d1bdqa_ (1bdq A:)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)

4. Superfamily b.50.1: Acid proteases [50630] (2 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)

6. Protein Human immunodeficiency virus type 1 protease [50632] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (119 PDB entries)

8. Domain d1bdqa_: 1bdq A: [26686]

Details for d1bdqa_

PDB Entry: 1bdq, 2.5 Å

PDB Description: hiv-1 (2:31-37, 47, 82) protease complexed with inhibitor sb203386

SCOP Domain Sequences for d1bdqa_:

Sequence; same for both SEQRES and ATOM records:

>d1bdqa_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtikiggqlkealldtgaddsivagielpgrwkpkmvggiggfikvrqyd
qilieicghkaigtvlvgptpiniigrnlltqigctlnf

Timeline for d1bdqa_:

• d1bdqa_ first appeared (with stable ids) in SCOP 1.55
  
• d1bdqa_ appears in SCOP 1.59
  
• d1bdqa_ appears in the current release, SCOPe 2.08