Lineage for d4mx4a_ (4mx4 A:)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2244155Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2244156Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2245342Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2245343Protein automated matches [190857] (40 species)
    not a true protein
  7. 2245657Species Pseudomonas aeruginosa [TaxId:287] [189201] (28 PDB entries)
  8. 2245678Domain d4mx4a_: 4mx4 A: [266837]
    automated match to d4mxga_
    complexed with cl, edo, flc, ipa, pge

Details for d4mx4a_

PDB Entry: 4mx4 (more details), 1.6 Å

PDB Description: crystal structure of extended-spectrum beta-lactamase bel-1 (orthorhombic form)
PDB Compounds: (A:) bel-1

SCOPe Domain Sequences for d4mx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mx4a_ e.3.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
dfehaisdleahnqakigvalvsengnliqgyranerfamcstfklplaalvlsridage
enperklhydsafleeyapaakryvatgymtvteaiqsalqlsdnaaanlllkevggppl
ltkyfrslgdkvsrldrieptlntntpgderdtttpmsmaqtvsklifgdtltykskgql
rrllignqtgdktiraglpdswvtgdktgscanggrndvaffittagkkyvlsvytnape
lqgeeralliasvaklarqyvvh

SCOPe Domain Coordinates for d4mx4a_:

Click to download the PDB-style file with coordinates for d4mx4a_.
(The format of our PDB-style files is described here.)

Timeline for d4mx4a_: