Class a: All alpha proteins [46456] (290 folds) |
Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) |
Family a.27.1.0: automated matches [227164] (1 protein) not a true family |
Protein automated matches [226872] (13 species) not a true protein |
Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries) |
Domain d4mwda2: 4mwd A:607-768 [266830] Other proteins in same PDB: d4mwda1, d4mwdb1, d4mwdb3 automated match to d4mvyb1 protein/RNA complex; complexed with 43e, acp, dms, gol, met, so4 |
PDB Entry: 4mwd (more details), 2.25 Å
SCOPe Domain Sequences for d4mwda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mwda2 a.27.1.0 (A:607-768) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]} adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd mlgvpevhrkgienfefgavppgtrlgpavegevlfskrste
Timeline for d4mwda2: