Lineage for d4mw7a2 (4mw7 A:607-767)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705920Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 2705921Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 2705974Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 2705975Protein automated matches [226872] (13 species)
    not a true protein
  7. 2706078Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [226413] (15 PDB entries)
  8. 2706103Domain d4mw7a2: 4mw7 A:607-767 [266814]
    Other proteins in same PDB: d4mw7a1, d4mw7b1, d4mw7b3
    automated match to d4mvyb1
    protein/RNA complex; complexed with 2ef, dms, gol, met, so4

Details for d4mw7a2

PDB Entry: 4mw7 (more details), 2.75 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(5-chloro-2-ethoxy-3-iodobenzyl)amino]propyl}-3-thiophen-3-ylurea (Chem 1469)
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mw7a2:

Sequence, based on SEQRES records: (download)

>d4mw7a2 a.27.1.0 (A:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavegevlfskrst

Sequence, based on observed residues (ATOM records): (download)

>d4mw7a2 a.27.1.0 (A:607-767) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
adtlgnlvmrctsakinvngewpspaayteedesliqlikdlpgtadhyylipdiqkaii
avfdvlrainayvtdmapwklvktdperlrtvlyitlegvrvttlllspilprksvvifd
mlgvpevhrkgienfefgavppgtrlgpavgevlfskrst

SCOPe Domain Coordinates for d4mw7a2:

Click to download the PDB-style file with coordinates for d4mw7a2.
(The format of our PDB-style files is described here.)

Timeline for d4mw7a2: