SCOPe 2.08: Domain d4mw0a1: 4mw0 A:238-606

Lineage for d4mw0a1 (4mw0 A:238-606)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (61 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188998] (16 PDB entries)

8. Domain d4mw0a1: 4mw0 A:238-606 [266789]
   Other proteins in same PDB: d4mw0a2, d4mw0b1, d4mw0b3
   automated match to d4mvyb2
   protein/RNA complex; complexed with 392, dms, gol, met

Details for d4mw0a1

PDB Entry: 4mw0, 2.2 Å

PDB Description: Trypanosoma brucei methionyl-tRNA synthetase in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-(2-hydroxyphenyl)urea (Chem 1392)

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d4mw0a1:

Sequence; same for both SEQRES and ATOM records:

>d4mw0a1 c.26.1.0 (A:238-606) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
vekvffvtspiyyvnaaphighvystlitdvigryhrvkgervfaltgtdehgqkvaeaa
kqkqvspydfttavagefkkcfeqmdysidyfirttneqhkavvkelwtkleqkgdiylg
ryegwysisdesfltpqnitdgvdkdgnpckvslesghvvtwvseenymfrlsafrerll
ewyhanpgcivpefrrreviravekglpdlsvsraratlhnwaipvpgnpdhcvyvwlda
ltnyltgsrlrvdesgkevslvddfnelerfpadvhvigkdilkfhaiywpafllsaglp
lpkkivahgwwtkdrkkiskslgnvfdpvekaeefgydalkyfllresgfsddgdysdkn
miarlngel

Timeline for d4mw0a1:

• d4mw0a1 first appeared in SCOPe 2.05
  
• d4mw0a1 appears in SCOPe 2.07