Class a: All alpha proteins [46456] (286 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families) contains one classic and one pseudo HhH motifs |
Family a.60.12.0: automated matches [254215] (1 protein) not a true family |
Protein automated matches [254483] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255047] (5 PDB entries) |
Domain d4lzda2: 4lzd A:231-289 [266711] Other proteins in same PDB: d4lzda1, d4lzda3 automated match to d2ihma2 complexed with cl, edo, imd, na |
PDB Entry: 4lzd (more details), 1.85 Å
SCOPe Domain Sequences for d4lzda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lzda2 a.60.12.0 (A:231-289) automated matches {Human (Homo sapiens) [TaxId: 9606]} seryqtmklftqifgvgvktadrwyreglrtlddlreqpqkltqqqkaglqhhqdlstp
Timeline for d4lzda2: