Lineage for d4ls8b2 (4ls8 B:252-413)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1881081Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 1881082Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 1881785Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 1881786Protein automated matches [196909] (52 species)
    not a true protein
  7. 1881810Species Bacillus subtilis [TaxId:224308] [238173] (4 PDB entries)
  8. 1881826Domain d4ls8b2: 4ls8 B:252-413 [266695]
    automated match to d2alma2
    complexed with 1xg, cl, edo, na

Details for d4ls8b2

PDB Entry: 4ls8 (more details), 2.1 Å

PDB Description: Crystal structure of Bacillus subtilis beta-ketoacyl-ACP synthase II (FabF) in a covalent complex with cerulenin
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4ls8b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ls8b2 c.95.1.0 (B:252-413) automated matches {Bacillus subtilis [TaxId: 224308]}
kiygeivgygstgdayhitapaqdgeggaramqeaikdagiapeeidyinahgtstyynd
kyetmaiktvfgehahklavsstksmtghllgaaggieaifsilaikegvipptiniqtp
deecdldyvpdearrqelnyvlsnslgfgghnatlifkkyqs

SCOPe Domain Coordinates for d4ls8b2:

Click to download the PDB-style file with coordinates for d4ls8b2.
(The format of our PDB-style files is described here.)

Timeline for d4ls8b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4ls8b1