SCOPe 2.08: Domain d4lp2b_: 4lp2 B:

Lineage for d4lp2b_ (4lp2 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
   has additional insertions and/or extensions that are not grouped together
   

6. Protein automated matches [190140] (37 species)
   not a true protein

7. Species Salmonella enterica [TaxId:99287] [227690] (7 PDB entries)

8. Domain d4lp2b_: 4lp2 B: [266687]
   automated match to d4gwoa_

Details for d4lp2b_

PDB Entry: 4lp2, 2.3 Å

PDB Description: Crystal structure of monomeric ligand binding domain of S. typhimurium CysB, a LysR transcriptional regulator at 2.2A

PDB Compounds: (B:) HTH-type transcriptional regulator CysB

SCOPe Domain Sequences for d4lp2b_:

Sequence; same for both SEQRES and ATOM records:

>d4lp2b_ c.94.1.1 (B:) automated matches {Salmonella enterica [TaxId: 99287]}
ehtwpdkgslyiatthtqaryalpgvikgfieryprvslhmhqgsptqiaeavskgnadf
aiatealhlyddlvmlpcyhwnrsivvtpdhplaatssvtiealaqyplvtytfgftgrs
eldtafnragltprivftatdadviktyvrlglgvgviasmavdpladpdlvridahdif
shsttkigfrrstflrsymydfiqrfaphltrdvvdtavalrsneeieamfqdiklpek

Timeline for d4lp2b_:

• d4lp2b_ first appeared in SCOPe 2.05
  
• d4lp2b_ appears in SCOPe 2.07