SCOPe 2.08: Domain d4lf2b1: 4lf2 B:1-138

Lineage for d4lf2b1 (4lf2 B:1-138)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.0: automated matches [227234] (1 protein)
   not a true family

6. Protein automated matches [226983] (27 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:258594] [257015] (3 PDB entries)

8. Domain d4lf2b1: 4lf2 B:1-138 [266661]
   Other proteins in same PDB: d4lf2a2, d4lf2b2, d4lf2c2, d4lf2d2, d4lf2e2, d4lf2f2
   automated match to d4lf1a1
   complexed with co3, mg, so4

Details for d4lf2b1

PDB Entry: 4lf2, 2.38 Å

PDB Description: hexameric form ii rubisco from rhodopseudomonas palustris, activated and complexed with sulfate and magnesium

PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d4lf2b1:

Sequence; same for both SEQRES and ATOM records:

>d4lf2b1 d.58.9.0 (B:1-138) automated matches {Rhodopseudomonas palustris [TaxId: 258594]}
mdqsnryanlnlkeseliaggrhvlcayimkpkagfgnfiqtaahfaaesstgtnvevst
tddftrgvdalvyevdeanslmkiaypielfdrnvidgramiasfltltignnqgmgdve
yakmydfyvppaylklfd

Timeline for d4lf2b1:

• d4lf2b1 first appeared in SCOPe 2.05
  
• d4lf2b1 appears in SCOPe 2.07