SCOPe 2.06: Domain d4le1b_: 4le1 B:

Lineage for d4le1b_ (4le1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (8 families)

5. Family c.23.1.0: automated matches [191324] (1 protein)
   not a true family

6. Protein automated matches [190131] (71 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)

8. Domain d4le1b_: 4le1 B: [266658]
   automated match to d4le2a_
   complexed with act, gol, so4

Details for d4le1b_

PDB Entry: 4le1, 1.95 Å

PDB Description: crystal structure of the receiver domain of desr in the inactive state

PDB Compounds: (B:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d4le1b_:

Sequence; same for both SEQRES and ATOM records:

>d4le1b_ c.23.1.0 (B:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

Timeline for d4le1b_:

• d4le1b_ first appeared in SCOPe 2.05
  
• d4le1b_ appears in SCOPe 2.07
  
• d4le1b_ appears in the current release, SCOPe 2.08