Lineage for d4hvpb_ (4hvp B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15694Fold b.50: Acid proteases [50629] (1 superfamily)
  4. 15695Superfamily b.50.1: Acid proteases [50630] (2 families) (S)
  5. 15696Family b.50.1.1: Retroviral protease (retropepsin) [50631] (7 proteins)
  6. 15712Protein Human immunodeficiency virus type 1 protease [50632] (1 species)
  7. 15713Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (108 PDB entries)
  8. 15875Domain d4hvpb_: 4hvp B: [26663]

Details for d4hvpb_

PDB Entry: 4hvp (more details), 2.3 Å

PDB Description: structure of complex of synthetic hiv-1 protease with a substrate- based inhibitor at 2.3 angstroms resolution

SCOP Domain Sequences for d4hvpb_:

Sequence, based on SEQRES records: (download)

>d4hvpb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveixghkaigtvlvgptpvniigrnlltqigxtlnf

Sequence, based on observed residues (ATOM records): (download)

>d4hvpb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1}
pqitlwqrplvtiriggqlkealldtgaddtvleemnlpgkwkpkmiggiggfikvrqyd
qipveighkaigtvlvgptpvniigrnlltqigtlnf

SCOP Domain Coordinates for d4hvpb_:

Click to download the PDB-style file with coordinates for d4hvpb_.
(The format of our PDB-style files is described here.)

Timeline for d4hvpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4hvpa_